Tesamorelin

The recovery peptide.

Purity 99.38%

Method HPLC

Batch / Lot Lot 032026

View the certificate

$80.00

In stock

Supports growth hormone release and body composition.

✓ Studied for cellular energy and metabolism
✓ Explored in longevity and DNA repair research
✓ 99%+ purity, lab verified

Strength

Purchase Option

View COAs

99%+ Purity

100% Lab Verified

USA Sourced

For research use only. Not for human consumption. Products are not intended to diagnose, treat, cure, or prevent any disease. By purchasing, you confirm that you are 21+ and conducting legitimate laboratory research.

PRODUCT INFORMATION

Overview

Molecular Formula: C223H370N72O69S
Molecular Weight: 5195.9 g/mol
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Tesmorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH) that has been extensively studied for its ability to stimulate the release of growth hormone (GH). By mimicking the natural GHRH, Tesmorelin promotes anabolic processes and has been widely used in research related to metabolism, fat distribution, and cellular regeneration. Tesmorelin is provided in lyophilized powder form for research applications involving growth hormone regulation and metabolic health.

Research Information

Tesmorelin is actively researched for its potential to:

Enhance Growth Hormone Secretion: Investigate its role in stimulating endogenous growth hormone release.
Support Fat Metabolism: Study its effects on reducing visceral adipose tissue and improving metabolic health.
Improve Muscle Mass: Explore its potential in increasing lean body mass through anabolic processes.
Promote Cognitive Function: Research its impact on cognitive health and neuroprotection through GH regulation.

Storage

Store lyophilized powder at -20°C.
Once reconstituted, store at 2-8°C and use promptly.
Maintain aseptic techniques during handling to ensure sterility.

Shipping

Store lyophilized Tesamorelin at -20°C for long-term stability, protected from light. Once reconstituted, store refrigerated at 2–8°C and use within the recommended window to preserve molecular integrity.

QUESTIONS

Everything you need to know about Tesamorelin, from purity verification to storage and reconstitution.

Every batch of Tesamorelin is independently verified at 99%+ purity using HPLC and mass spectrometry by accredited U.S. laboratories. A Certificate of Analysis (COA) is available upon request.

Reconstitute with bacteriostatic water by adding it slowly against the vial wall, then gently swirl until fully dissolved. Store the reconstituted solution refrigerated at 2–8°C.

No. Tesamorelin is sold strictly for laboratory and research use only. It is not intended to diagnose, treat, cure, or prevent any disease and is not for human or veterinary consumption.

All products are sourced and shipped from the USA with tracking. Orders are typically processed within 1–2 business days.

Puravita Solutions