RESEARCH USE ONLY

Before entering, please confirm the following information. Our products are intended strictly for laboratory and scientific research purposes.

I'm under 21 — Leave Site

By entering this website you acknowledge that you are at least 21 years old and understand that all products sold by Puravita are intended exclusively for laboratory and research purposes.

0
← Back to Shop

Tesamorelin

Purity 99.38%
Method HPLC
Batch / Lot Lot 032026
View the certificate
$68.00

In stock

Supports growth hormone release and body composition.

  • ✓ Studied for cellular energy and metabolism
  • ✓ 99%+ purity, lab verified
View COAs
99%+ Purity
100% Lab Verified
USA Sourced
For research use only. Not for human consumption. Products are not intended to diagnose, treat, cure, or prevent any disease. By purchasing, you confirm that you are 21+ and conducting legitimate laboratory research.
Certificate
1 / 1

PRODUCT INFORMATION

Overview

Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S
Molecular Weight: 5195.9 g/mol
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Tesamorelin molecular structure

Research Information

This is provided strictly for laboratory research and analytical purposes. It is not intended for human or veterinary use, diagnostic purposes, or therapeutic applications.

Storage

Store lyophilized powder at -20°C.
Protect from excessive heat, moisture, and direct light.
If prepared for laboratory analysis, store at 2–8°C and use promptly according to the applicable research protocol.
Follow appropriate laboratory handling and safety procedures.

Shipping

Orders are processed within 1–2 business days and shipped from the USA with tracking. Products are packaged appropriately for transit to help protect material integrity.

QUESTIONS

Everything you need to know about Tesamorelin, from purity verification to storage and reconstitution.

Every batch of Tesamorelin is independently verified at 99%+ purity using HPLC and mass spectrometry by accredited U.S. laboratories. A Certificate of Analysis (COA) is available upon request.

Reconstitute with bacteriostatic water by adding it slowly against the vial wall, then gently swirl until fully dissolved. Store the reconstituted solution refrigerated at 2–8°C.

No. Tesamorelin is sold strictly for laboratory and research use only. It is not intended to diagnose, treat, cure, or prevent any disease and is not for human or veterinary consumption.

All products are sourced and shipped from the USA with tracking. Orders are typically processed within 1–2 business days.

✓

Product added to cart